compare

Comparison List

G1

G1 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Clavularia sp..
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

FPbase ID: O2UFD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 503 26,000 0.6 15.6      

Photostability

No photostability measurements available ... add one!

G1 Sequence

G1 was derived from mTFP1 with the following mutations: H201M
amino acid numbers relative to cFP484. show relative to mTFP1

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKMKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK

Excerpts

No excerpts have been added for G1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change