compare

Comparison List

mTFP1

mTFP1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Clavularia sp.. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

FPbase ID: ASSY9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
462 492 64,000 0.85 54.4 4.3   3.2

mTFP1 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
92.0 ± 1.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
163.0   Ai et al. (2006)

mTFP1 Sequence

mTFP1 was derived from mTFP0.9 with the following mutations: L179T/V196K/Y259N/G261aD
amino acid numbers relative to cFP484. show relative to mTFP0.9

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK
GenBank: ABG77397
IPG: 5860107

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mTFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change