compare

Comparison List

HcRed

HcRed is a basic (constitutively fluorescent) red fluorescent protein published in 2001, derived from Heteractis crispa.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Heteractis crispa 25.6 kDa -

FPbase ID: LP3PQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
592 645 20,000 0.015 0.3      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

HcRed Sequence

BLAST
MAGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFAGTQSMRIHVTEGAPLPFAFDILAPCCEYGSRTFVHHTAEIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVHGTNFPADGPVMKNKSGGWEPSTEVVYPENGVLCGRNVMALKVGDRHLICHHYTSYRSKKAVRALTMPGFHFTDIRLQMLRKKKDEYFELYEASVARYSDLPEKAN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for HcRed
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

GFP-like chromoproteins as a source of far-red fluorescent proteins

Gurskaya Ng, Fradkov Af, Terskikh A, Matz Mv, Labas Ya, Martynov Vi, Yanushevich Yg, Lukyanov Ka, Lukyanov Sa

(2001). FEBS Letters, 507(1) , 16-20. doi: 10.1016/s0014-5793(01)02930-1. Article

Additional References

  1. Conversion of Red Fluorescent Protein into a Bright Blue Probe

    Subach Om, Gundorov Is, Yoshimura M, Subach Fv, Zhang J, Grüenwald D, Souslova Ea, Chudakov Dm, Verkhusha Vv

    (2008). Chemistry & Biology, 15(10) , 1116-1124. doi: 10.1016/j.chembiol.2008.08.006. Article   Pubmed

  2. The 2.1Å Crystal Structure of the Far-red Fluorescent Protein HcRed: Inherent Conformational Flexibility of the Chromophore

    Wilmann Pg, Petersen J, Pettikiriarachchi A, Buckle Am, Smith Sc, Olsen S, Perugini Ma, Devenish Rj, Prescott M, Rossjohn J

    (2005). Journal of Molecular Biology, 349(1) , 223-237. doi: 10.1016/j.jmb.2005.03.020. Article   Pubmed

  3. Far-red fluorescent tag for protein labelling

    Fradkov Af, Verkhusha Vv, Staroverov Db, Bulina Me, Yanushevich Yg, Martynov Vi, Lukyanov S, Lukyanov Ka

    (2002). Biochemical Journal, 368(1) , 17-21. doi: 10.1042/bj20021191. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change