compare

Comparison List

QC2-6

QC2-6 is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Cytaeis uchidae 25.6 kDa -

FPbase ID: L3PJW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 504          

Photostability

No photostability measurements available ... add one!

QC2-6 Sequence

QC2-6 was derived from (n1)oxStayGold with the following mutations: N132D/P151T/L155T/K162E
amino acid numbers relative to CU17S. show relative to (n1)oxStayGold

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMDVSLPNEVQHIPRDDGVECTVTLTYPLLSDESKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHL

Excerpts

We comprehensively prepared several libraries of (n1)oxStayGold variants that carried different partial mutations at the interface. In one attempt, we focused on threonine substitution at Pro151 and Leu155 and screened candidates in a library of (n1)oxStayGold P151T/L155T iteratively with multiple cycles of random mutagenesis to produce QC2-6. This variant contained four mutations (P151T, L155T, N132D and K162E) relative to (n1)oxStayGold. When observing the fluorescence in the cytosolic and nuclear compartments of transfected cells under intense illumination, we confirmed that QC2-6 was highly photostable and bright.

Ando et al. (2023)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change