compare

Comparison List

(n1)oxStayGold

a.k.a. (n1)oxSG

(n1)oxStayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Cytaeis uchidae 25.6 kDa -

FPbase ID: 2NNZY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
497 506          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

(n1)oxStayGold Sequence

BLAST

(n1)oxStayGold was derived from oxStayGold with the following mutations: A2V/T4_P5insGEELFTGVV

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHL

Excerpts

No excerpts have been added for (n1)oxStayGold
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A highly photostable and bright green fluorescent protein

Hirano M, Ando R, Shimozono S, Sugiyama M, Takeda N, Kurokawa H, Deguchi R, Endo K, Haga K, Takai-Todaka R, Inaura S, Matsumura Y, Hama H, Okada Y, Fujiwara T, Morimoto T, Katayama K, Miyawaki A

(2022). Nature Biotechnology, , . doi: 10.1038/s41587-022-01278-2. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change