compare

Comparison List

tKeima

tKeima is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2006, derived from Montipora sp. 20. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora sp. 20 25.0 kDa -

FPbase ID: F1MW1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 616 14,500 0.22 3.19 6.5   2.4

Photostability

No photostability measurements available ... add one!

tKeima Sequence

tKeima was derived from Montipora sp. #20-9115 with the following mutations: S61F/I92T/F158Y/S213A
amino acid numbers relative to Montipora sp. #20. show relative to Montipora sp. #20-9115

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLFQYGSIPFTKYPEDIPDYVKQSFPEGYTWERTMNFEDGAVCTVSNDSSIQGNCFIYNVKISGVNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNRDYTSVEQCEIAIARHSLLG
GenBank: BAE93224
UniProtKB: Q1JV72
IPG: 5593666

Excerpts

No excerpts have been added for tKeima
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change