compare

Comparison List

Montipora sp. #20-9115

Montipora sp. #20-9115 is a red fluorescent protein derived from Montipora sp. It was an intermediate protein in the evolution of the Keima family of fluorescent proteins.
+
Oligomerization Organism Molecular Weight Cofactor
? Montipora sp. 20 25.0 kDa -

FPbase ID: C69E5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
580 606          

Photostability

No photostability measurements available ... add one!

Montipora sp. #20-9115 Sequence

Montipora sp. #20-9115 was derived from Montipora sp. #20 with the following mutations: M1_S2insV/H94N/N142S/N157D/K202R/F206S

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKISGVNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDFMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNRDYTSVEQCEISIARHSLLG

Excerpts

No excerpts have been added for Montipora sp. #20-9115
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change