compare

Comparison List

Sumire

Sumire is a basic (constitutively fluorescent) uv fluorescent protein published in 2022, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.3 kDa -

FPbase ID: EG3EK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
343 414 20,000 0.7 14.0      

Photostability

No photostability measurements available ... add one!

Sumire Sequence

Sumire was derived from Superfolder GFP with the following mutations: T65G/Q69A/Y143G/N146I/H148G/F165Y/T203V/S205V/V224R

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLGYGVACFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNGISGNVYITADKQKNGIKANYKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSVQVVLSKDPNEKRDHMVLLEFRTAAGITHGMDE

Excerpts

No excerpts have been added for Sumire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change