compare

Comparison List

Gamillus0.5

a.k.a. GFP with acid tolerance and monomeric properties to illuminate soured environments

Gamillus0.5 is a fluorescent protein published in 2018, derived from Olindias formosus. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Olindias formosus 25.6 kDa -

FPbase ID: E5GAC

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Gamillus0.5 Sequence

Gamillus0.5 was derived from Gamillus0.4 with the following mutations: E140K/Q145E/K166E

MASGRALFQYPMTSKIELNGEINGKKFKVAGEGFTPSSGRFNMHAYCTTGDLPMSWVVIASPLQYGFHMFAHYPEDITHFFQECFPGSYTLDRTLRMEGDGTLTTHHEYSLEDGCVTSKTTLNASGFDPKGATMTKSFVKQLPNEVKITAEGNGIRLTSTVLYLKEDGTIQIGTQDCIVKPVGGRKVTQPKAHFLHTQIIQKKDPNDTRDHIVQTELAVAGNLWHEPSASAV

Excerpts

No excerpts have been added for Gamillus0.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Acid-Tolerant Monomeric GFP from Olindias formosa

Shinoda H, Ma Y, Nakashima R, Sakurai K, Matsuda T, Nagai T

(2018). Cell Chemical Biology, 25(3) , 330-338.e7. doi: 10.1016/j.chembiol.2017.12.005. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change