compare

Comparison List

DarkVenus

DarkVenus is a basic (constitutively fluorescent) yellow fluorescent protein published in 2013, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: B8S8J

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 525 74,400 0.05 3.72      

Photostability

No photostability measurements available ... add one!

DarkVenus Sequence

DarkVenus was derived from Venus with the following mutations: Y145W/H148V
amino acid numbers relative to avGFP. show relative to Venus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNWNSVNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for DarkVenus
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highlighted Ca2+ imaging with a genetically encoded ‘caged’ indicator

Matsuda T, Horikawa K, Saito K, Nagai T

(2013). Scientific Reports, 3(1) , 1398. doi: 10.1038/srep01398. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change