compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

PSLSSmKate

This protein has unmoderated changes.

PSLSSmKate is a photoswitchable long stokes shift fluorescent protein published in 2014, derived from Entacmaea quadricolor. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Entacmaea quadricolor	26.2 kDa	-

FPbase ID: 9S2ZE

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
LSS	445	622	26,500	0.21	5.57	6.5	90.0
Red	573	621	8,500	0.16	1.36	8.2

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

PSLSSmKate Sequence

BLAST

PSLSSmKate was derived from LSS-mKate1 with the following mutations: Y67K/G143SY67K/G143S

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDEALKLVGGGHLICNLKSTYRSKKPAKNLKVPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for PSLSSmKate
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Photoswitchable Red Fluorescent Protein with a Large Stokes Shift

Piatkevich Kd, English Bp, Malashkevich Vn, Xiao H, Almo Sc, Singer Rh, Verkhusha Vv

(2014). Chemistry & Biology, 21(10) , 1402-1414. doi: 10.1016/j.chembiol.2014.08.010. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for PSLSSmKate
Search RIKEN BRC for PSLSSmKate

Change history

Something missing or incorrect? Submit a change Submit a change