compare

Comparison List

LSS-mKate1

LSS-mKate1 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2010, derived from Entacmaea quadricolor. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.2 kDa -

FPbase ID: GLJ6S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
463 624 31,200 0.08 2.5 3.2 100.0  

Photostability

No photostability measurements available ... add one!

LSS-mKate1 Sequence

LSS-mKate1 was derived from mKate with the following mutations: K67Y/P127T/S143G/M160E/T176S/M189V/*230LextN
amino acid numbers relative to eqFP578. show relative to mKate

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSYTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFTSNGPVMQKKTLGWEAGTEMLYPADGGLEGRSDEALKLVGGGHLICNLKSTYRSKKPAKNLKVPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for LSS-mKate1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomeric red fluorescent proteins with a large Stokes shift

Piatkevich Kd, Hulit J, Subach Om, Wu B, Abdulla A, Segall Je, Verkhusha Vv

(2010). Proceedings of the National Academy of Sciences, 107(12) , 5369-5374. doi: 10.1073/pnas.0914365107. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change