compare

Comparison List

mLychee

a.k.a. mLy

mLychee is a basic (constitutively fluorescent) red fluorescent protein published in 2024, derived from Discosoma sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.5 kDa -

FPbase ID: 893F3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 596 80,000 0.5 40.0 6.3 36.4  

Photostability

No photostability measurements available ... add one!

mLychee Sequence

mLychee was derived from mApple with the following mutations: V1a_M6bdelinsDSTE/V71A/L85Q/S131P/K139R/A145P/I210V/T221b_E222delinsGSQGGSGGS

MDSTEAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYIKHPADIPDYFKQSFPEGFRWERVMNFEDGGIIHVNQDSSLQDGVFIYKVKLRGTNFPPDGPVMQKRTMGWEPSEERMYPEDGALKSEIKKRLKLKDGGHYAAEVKTTYKAKKPVQLPGAYIVDIKLDIVSHNEDYTVVEQYERAEGRHSGSQGGSGGSLYK

Excerpts

No excerpts have been added for mLychee
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change