compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mLychee

a.k.a. mLy

You are viewing an older revision of this protein, from Jun 4, 2024 13:02:34. Click here to view the current version.

mLychee is a basic (constitutively fluorescent) red fluorescent protein published in 2024, derived from Aequorea victoria.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.5 kDa	-

FPbase ID: 893F3

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
570	593

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mLychee Sequence

BLAST

mLychee was derived from mApple with the following mutations: V2_M10delinsDSTE/V76A/L90Q/S136P/K144R/A150P/I215V/T228_E233delinsGSQGGSGGSV1a_M6bdelinsDSTE/V71A/L85Q/S131P/K139R/A145P/I210V/T221b_E222delinsGSQGGSGGS

MDSTEAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYIKHPADIPDYFKQSFPEGFRWERVMNFEDGGIIHVNQDSSLQDGVFIYKVKLRGTNFPPDGPVMQKRTMGWEPSEERMYPEDGALKSEIKKRLKLKDGGHYAAEVKTTYKAKKPVQLPGAYIVDIKLDIVSHNEDYTVVEQYERAEGRHSGSQGGSGGSLYK

Excerpts

No excerpts have been added for mLychee
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A palette of bright and photostable monomeric fluorescent proteins for bacterial time-lapse imaging

Fraikin N, Couturier A, Lesterlin C

(2024). , , . doi: 10.1101/2024.03.28.587235. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for mLychee
Search RIKEN BRC for mLychee

Change history

Something missing or incorrect? Submit a change Submit a change