compare

Comparison List

mClavGR1.1

mClavGR1.1 is a fluorescent protein published in 2010, derived from Clavularia sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.1 kDa -

FPbase ID: 68QLV

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mClavGR1.1 Sequence

BLAST

mClavGR1.1 was derived from mClavGR1 with the following mutations: T42I/S72R/K74R/K112R/M151I/L204Q/Y211H
amino acid numbers relative to cFP484. show relative to mClavGR1

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGRGRPFEGTQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTRYPDDIPDYFKQSFPEGYSWERSMTFEDGGICIATNDITIEKDSFINKIHFKGENFPPNGPVMQKKTVGWEASTEKMYVRDGVLKGDVKMKLQLKGGGHHRCDFRTTYKAKQKAVKLPDYHFVDHRIEILSHDKDYNKVKLYEHAVAHSGLPGMDELYK

Excerpts

No excerpts have been added for mClavGR1.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Monomeric Photoconvertible Fluorescent Protein for Imaging of Dynamic Protein Localization

Hoi H, Shaner Nc, Davidson Mw, Cairo Cw, Wang J, Campbell Re

(2010). Journal of Molecular Biology, 401(5) , 776-791. doi: 10.1016/j.jmb.2010.06.056. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change