compare

Comparison List

HcRed1-Blue

HcRed1-Blue is a basic (constitutively fluorescent) blue fluorescent protein published in 2008, derived from Heteractis crispa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Heteractis crispa 25.6 kDa -

FPbase ID: 1ZQEX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
408 455          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

HcRed1-Blue Sequence

BLAST

HcRed1-Blue was derived from HcRed with the following mutations: E63H/R67K/F80W/S143I/N158A/H173A/I196Y

MAGLLKESMRIKMYMEGTVNGHYFKCEGEGDGNPFAGTQSMRIHVTEGAPLPFAFDILAPCCHYGSKTFVHHTAEIPDFWKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVHGTNFPADGPVMKNKSGGWEPITEVVYPENGVLCGRAVMALKVGDRHLICHAYTSYRSKKAVRALTMPGFHFTDYRLQMLRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for HcRed1-Blue
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Conversion of Red Fluorescent Protein into a Bright Blue Probe

Subach Om, Gundorov Is, Yoshimura M, Subach Fv, Zhang J, Grüenwald D, Souslova Ea, Chudakov Dm, Verkhusha Vv

(2008). Chemistry & Biology, 15(10) , 1116-1124. doi: 10.1016/j.chembiol.2008.08.006. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change