compare

Comparison List

d2EosFP

a.k.a. dimer 2 EosFP

d2EosFP is a photoconvertible red fluorescent protein published in 2004, derived from Lobophyllia hemprichii.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 1SEDF

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 506 516 84,000 0.66 55.44      
Red 569 581 33,000 0.6 19.8      

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

d2EosFP Sequence

d2EosFP was derived from EosFP with the following mutations: T158H

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for d2EosFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

EosFP, a fluorescent marker protein with UV-inducible green-to-red fluorescence conversion

Wiedenmann J, Ivanchenko S, Oswald F, Schmitt F, Rocker C, Salih A, Spindler K-D, Nienhaus Gu

(2004). Proceedings of the National Academy of Sciences, 101(45) , 15905-15910. doi: 10.1073/pnas.0403668101. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change