compare

Comparison List

W2

W2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: OMA2X

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
432 480 10,000 0.71 7.1      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

W2 Sequence

BLAST

W2 was derived from CFP with the following mutations: I123V/Y145H/H148R/M153T/V163A/N212K

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRVELKGIDFKEDGNILGHKLEYNHNSRNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPKEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for W2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering green fluorescent protein for improved brightness, longer wavelengths and fluorescence resonance energy transfer

Heim R, Tsien Ry

(1996). Current Biology, 6(2) , 178-182. doi: 10.1016/s0960-9822(02)00450-5. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change