compare

Comparison List

Topaz

Topaz is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 1998, derived from Aequorea victoria.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 527 94,500 0.6 56.7      

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
91.9 ± 2.0 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

Topaz Sequence

Topaz was derived from avGFP with the following mutations: S65G/S72A/K79R/Q80R/T203Y/H231L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMRRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Topaz
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change