compare

Comparison List

td5StayGold

td5StayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tandem dimer Cytaeis uchidae 54.3 kDa -

FPbase ID: 9BOLR

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 504 155,000 0.91 141.05      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

td5StayGold Sequence

BLAST

td5StayGold was derived from tdStayGold with the following mutations: E4y_G4sdel/S4uH/S4wT/A4x_G4cdel/S4g_G4ydel/A4d_G4fdel/S4iT/G4k_G4hdelinsS/A4jE/G4kD/G4lN/K4mN/L4nI/L4n_M4oinsD

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHLPWHEPSASAVGHGTGSTGSGSSGTASSEDNNIDMVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL
GenBank: LC756335

Excerpts

No excerpts have been added for td5StayGold
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

StayGold variants for molecular fusion and membrane-targeting applications

Ando R, Shimozono S, Ago H, Takagi M, Sugiyama M, Kurokawa H, Hirano M, Niino Y, Ueno G, Ishidate F, Fujiwara T, Okada Y, Yamamoto M, Miyawaki A

(2023). Nature Methods, , . doi: 10.1038/s41592-023-02085-6. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change