compare

Comparison List

td-RFP639

td-RFP639 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It is reported to be a very slowly-maturing dimer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.2 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
589 631 90,400 0.16 14.46   480.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1.6 Kredel et al. (2008)

td-RFP639 Sequence

td-RFP639 was derived from RFP639 with the following mutations: T122R

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVRGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYCQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for td-RFP639
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change