compare

Comparison List

RFP639

RFP639 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.1 kDa -

FPbase ID: B3LN6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 639 69,000 0.18 12.42   90.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
29.0   Kredel et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

RFP639 Sequence

BLAST

RFP639 was derived from RFP618 with the following mutations: S158C

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYCQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for RFP639
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Optimized and Far-Red-Emitting Variants of Fluorescent Protein eqFP611

Kredel S, Nienhaus K, Oswald F, Wolff M, Ivanchenko S, Cymer F, Jeromin A, Michel Fj, Spindler K-D, Heilker R, Nienhaus Gu, Wiedenmann J

(2008). Chemistry & Biology, 15(3) , 224-233. doi: 10.1016/j.chembiol.2008.02.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change