compare

Comparison List

td-RFP639

td-RFP639 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.2 kDa -

FPbase ID: A77ZH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
589 631 90,400 0.16 14.46   480.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1.6   Kredel et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

td-RFP639 Sequence

BLAST

td-RFP639 was derived from RFP639 with the following mutations: T122R

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVRGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYCQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for td-RFP639
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Optimized and Far-Red-Emitting Variants of Fluorescent Protein eqFP611

Kredel S, Nienhaus K, Oswald F, Wolff M, Ivanchenko S, Cymer F, Jeromin A, Michel Fj, Spindler K-D, Heilker R, Nienhaus Gu, Wiedenmann J

(2008). Chemistry & Biology, 15(3) , 224-233. doi: 10.1016/j.chembiol.2008.02.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change