compare

Comparison List

TagRFP657

TagRFP657 is a basic (constitutively fluorescent) far red fluorescent protein published in 2010, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.3 kDa -

FPbase ID: C2N5S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
611 657 34,000 0.1 3.4 5.0 125.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
55.0   Morozova et al. (2010)

TagRFP657 Sequence

TagRFP657 was derived from mKate with the following mutations: K6T/M41Q/K67H/F80W/S143H/S158T/D159A/M160L/L174F/R197Y/*230LextN
amino acid numbers relative to eqFP578. show relative to mKate

MSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATSFMYGSHTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEAHTEMLYPADGGLEGRTALALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDYRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Excerpts

No excerpts have been added for TagRFP657
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change