compare

Comparison List

T-Sapphire

similar: mT-Sapphire

T-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2003, derived from Aequorea victoria. It has low acid sensitivity.
+
T-Sapphire Spectrum Fluorescent protein T-Sapphire excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: NLY5P

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 44,000 0.6 26.4 4.9    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
25.0   Zapata-Hommer & Griesbeck (2003)

T-Sapphire Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for T-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change