compare

Comparison List

SYFP2

a.k.a. mVenus NB

SYFP2 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2006, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: GB9EO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 527 101,000 0.68 68.68 6.0 4.1 2.9

Photostability

No photostability measurements available ... add one!

SYFP2 Sequence

SYFP2 was derived from mVenus with the following mutations: L68V
amino acid numbers relative to avGFP. show relative to mVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: DQ092361

Excerpts

Changing leucine68 back to valine decreased the relative bleaching time of SYFP2 by 30%. Thus, mutation V68L contributes to the photostability of YFP.

Kremers et al. (2006)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change