compare

Comparison List

SYFP2

a.k.a. mVenus NB

SYFP2 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2006, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: GB9EO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 527 101,000 0.68 68.68 6.0 4.1 2.9
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

SYFP2 Sequence

BLAST

SYFP2 was derived from mVenus with the following mutations: L68V
amino acid numbers relative to avGFP. show relative to mVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: DQ092361

Excerpts

Changing leucine68 back to valine decreased the relative bleaching time of SYFP2 by 30%. Thus, mutation V68L contributes to the photostability of YFP.

Kremers et al. (2006)

Primary Reference

Cyan and Yellow Super Fluorescent Proteins with Improved Brightness, Protein Folding, and FRET Förster Radius†,‡

Kremers G-J, Goedhart J, Van Munster Eb, Gadella Twj

(2006). Biochemistry, 45(21) , 6570-6580. doi: 10.1021/bi0516273. Article   Pubmed

Additional References

  1. Systematic characterization of maturation time of fluorescent proteins in living cells

    Balleza E, Kim Jm, Cluzel P

    (2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change