compare

Comparison List

Sulfo-Cyanine5

Sulfo-Cyanine5 is a basic (constitutively fluorescent) near ir fluorescent protein published in 2022, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Cytaeis uchidae 24.7 kDa -

FPbase ID: Z97VJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
646 662 271,000 0.28 75.88      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Sulfo-Cyanine5 Sequence

BLAST

Sulfo-Cyanine5 was derived from StayGold with the following mutations: H169Y/C174I/C208I

MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHL
GenBank: LC601653

Excerpts

The oxStayGold variant of StayGold was engineered to efficiently label the ER from the inside. Because oxStayGold was found to label all subcellular components, including the cytoplasm, very brightly, it has replaced StayGold in many experiments; however, oxStayGold remains a dimer.

Ando et al. (2023)

Primary Reference

A highly photostable and bright green fluorescent protein

Hirano M, Ando R, Shimozono S, Sugiyama M, Takeda N, Kurokawa H, Deguchi R, Endo K, Haga K, Takai-Todaka R, Inaura S, Matsumura Y, Hama H, Okada Y, Fujiwara T, Morimoto T, Katayama K, Miyawaki A

(2022). Nature Biotechnology, , . doi: 10.1038/s41587-022-01278-2. Article   Pubmed

Additional References

  1. StayGold variants for molecular fusion and membrane-targeting applications

    Ando R, Shimozono S, Ago H, Takagi M, Sugiyama M, Kurokawa H, Hirano M, Niino Y, Ueno G, Ishidate F, Fujiwara T, Okada Y, Yamamoto M, Miyawaki A

    (2023). Nature Methods, , . doi: 10.1038/s41592-023-02085-6. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change