compare

Comparison List

spisCP

a.k.a. spisPink

spisCP is a fluorescent protein published in 2008, derived from Stylophora pistillata. It is reported to be a tetramer.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Stylophora pistillata 24.9 kDa -

FPbase ID: 1AR75

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560   61,000          

Photostability

No photostability measurements available ... add one!

spisCP Sequence

MSHSKQALADTMKMTWLMEGSVNGHAFTIEGEGTGKPYEGKQSGTFRVTKGGPLPFAFDIVAPTLKYGFKCFMKYPADIPDYFKLAFPEGLTYDRKIAFEDGGCATATVEMSLKGNTLVHKTNFQGGNFPIDGPVMQKRTLGWEPTSEKMTPCDGIIKGDTIMYLMVEGGKTLKCRYENNYRANKPVLMPPSHFVDLRLTRTNLDKEGLAFKLEEYAVARVLEV
GenBank: ABB17971
UniProtKB: A8CLX6
IPG: 4901569

Structure

Deposited: ,
Chromophore (KYG):

Excerpts

No excerpts have been added for spisCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Over the rainbow: structural characterization of the chromoproteins gfasPurple, amilCP, spisPink and eforRed

    Ahmed Fh, Caputo At, French Ng, Peat Ts, Whitfield J, Warden Ac, Newman J, Scott C

    (2022). Acta Crystallographica Section D Structural Biology, 78(5) , 599-612. doi: 10.1107/s2059798322002625. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change