compare

Comparison List

spisCP

spisCP is a fluorescent protein published in 2008, derived from Stylophora pistillata. It is reported to be a tetramer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Tetramer Stylophora pistillata 24.9 kDa -

FPbase ID: 1AR75

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

spisCP Sequence

MSHSKQALADTMKMTWLMEGSVNGHAFTIEGEGTGKPYEGKQSGTFRVTKGGPLPFAFDIVAPTLKYGFKCFMKYPADIPDYFKLAFPEGLTYDRKIAFEDGGCATATVEMSLKGNTLVHKTNFQGGNFPIDGPVMQKRTLGWEPTSEKMTPCDGIIKGDTIMYLMVEGGKTLKCRYENNYRANKPVLMPPSHFVDLRLTRTNLDKEGLAFKLEEYAVARVLEV
GenBank: ABB17971
UniProtKB: A8CLX6
IPG: 4901569

Excerpts

No excerpts have been added for spisCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and Evolution of Coral Fluorescent Proteins

Alieva No, Konzen Ka, Field Sf, Meleshkevitch Ea, Hunt Me, Beltran-Ramirez V, Miller Dj, Wiedenmann J, Salih A, Matz Mv

(2008). PLoS ONE, 3(7) , e2680. doi: 10.1371/journal.pone.0002680. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change