compare

Comparison List

spGFP1-10

a.k.a. splitGFP 1-10, spGFP1-10, spGFP1-10 OPT

spGFP1-10 is a basic (constitutively fluorescent) fluorescent protein published in 2005, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 24.0 kDa -

FPbase ID: 8B9TX

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

spGFP1-10 Sequence

spGFP1-10 was derived from Superfolder GFP with the following mutations: N39I/T105K/E111V/I128T/K166T/I167V/S205T/K214_Y237del

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTVLSKDPNEK

Excerpts

We evolved superfolder GFP 1–10 by DNA shuffling18 to improve its solubility and increase its complementation with sulfite reductase–GFP 11. After three rounds of shuffling and selection of the brightest clones, in vitro complementation of the soluble lysate of the best variant, termed GFP 1–10 OPT, improved 80-fold (Fig. 1b) relative to the same amount of refolded superfolder GFP 1–10. In addition to the folding reporter GFP mutations, GFP 1–10 OPT contains S30R, Y145F, I171V and A206V substitutions from superfolder GFP and seven new mutations: N39I, T105K, E111V, I128T, K166T, I167V and S205T.

Cabantous et al. (2005)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change