compare

Comparison List

Skylan-NS

a.k.a. sky lantern for nonlinear structured illumination

Skylan-NS is a photoswitchable green fluorescent protein published in 2016. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer <add one> 25.7 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 499 511 133,770 0.59 78.92 5.7    
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

no photostability measurements available ... add one!

Skylan-NS Sequence

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFLYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for Skylan-NS
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highly photostable, reversibly photoswitchable fluorescent protein with high contrast ratio for live-cell superresolution microscopy

Zhang X, Zhang M, Li D, He W, Peng J, Betzig E, Xu P

(2016). Proceedings of the National Academy of Sciences, 113(37) , 10364-10369. doi: 10.1073/pnas.1611038113. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change