compare

Comparison List

secBFP2

secBFP2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2013, derived from Entacmaea quadricolor.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.3 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 456          

Photostability

no photostability measurements available ... add one!

secBFP2 Sequence

MSEELIKENMHMKLYMEGTVDNHHFKATSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFLYGSKTFIDHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGSLIYNVKIRGVDFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKLVGGSHLIANAKTTYRSKKPAKNLKMPGVYYVDYRLERIKEANDETYVEQHEVAVARYSDLPSKLGHKLN

Excerpts

No excerpts have been added for secBFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change