compare

Comparison List

SCFP3B

SCFP3B is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: YVJ5E

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 474 30,000 0.5 15.0 4.5   2.3
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

SCFP3B Sequence

BLAST

SCFP3B was derived from SCFP3A with the following mutations: Y145A
amino acid numbers relative to avGFP. show relative to SCFP3A

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAZ65849
IPG: 4596888

Excerpts

No excerpts have been added for SCFP3B
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cyan and Yellow Super Fluorescent Proteins with Improved Brightness, Protein Folding, and FRET Förster Radius†,‡

Kremers G-J, Goedhart J, Van Munster Eb, Gadella Twj

(2006). Biochemistry, 45(21) , 6570-6580. doi: 10.1021/bi0516273. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change