compare

Comparison List

SCFP2

SCFP2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Aequorea victoria. It has very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: BSK5M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 474 29,000 0.41 11.89 3.5   2.3

Photostability

No photostability measurements available ... add one!

SCFP2 Sequence

SCFP2 was derived from SCFP1 with the following mutations: L68V
amino acid numbers relative to avGFP. show relative to SCFP1

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAZ65847
IPG: 4596894

Excerpts

No excerpts have been added for SCFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change