compare

Comparison List

SCFP1

SCFP1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2006, derived from Aequorea victoria. It is reported to be a somewhat slowly-maturing monomer with very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: 5NY15

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 477 29,000 0.24 6.96 3.5 50.9 1.5

Photostability

No photostability measurements available ... add one!

SCFP1 Sequence

SCFP1 was derived from mVenus with the following mutations: L46F/G65T/Y66W/N146I/Y203T
amino acid numbers relative to avGFP. show relative to mVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AAZ65846
IPG: 4596891

Excerpts

No excerpts have been added for SCFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change