compare

Comparison List

Rtms5

a.k.a. meffBlue

similar: mRtms5

Rtms5 is a red fluorescent protein published in 2003, derived from Montipora efflorescens. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Montipora efflorescens 24.9 kDa -

FPbase ID: B4SGV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
592 626 80,000 0.004 0.32 3.2    

Photostability

No photostability measurements available ... add one!

Rtms5 Sequence

MSVIATQMTYKVYMSGTVNGHYFEVEGDGKGRPYEGEQTVKLTVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGNCFTYHVKFSGLNFPPNGPVMQKKTQGWEPHSERLFARGGMLIGNNFMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA
UniProtKB: P83690

Structure

Deposited: ,
Chromophore (QYG):

Excerpts

No excerpts have been added for Rtms5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. The production, purification and crystallization of a pocilloporin pigment from a reef-forming coral

    Beddoe T, Ling M, Dove S, Hoegh-Guldberg O, Devenish Rj, Prescott M, Rossjohn J

    (2003). Acta Crystallographica Section D Biological Crystallography, 59(3) , 597-599. doi: 10.1107/s0907444902023466. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change