compare

Comparison List

mRtms5

similar: Rtms5

mRtms5 is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Montipora efflorescens 25.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 633 54,100 0.005 0.27      

Photostability

no photostability measurements available ... add one!

mRtms5 Sequence

MSVIATQMTYKVYMSGTVNGHYFEVEGDGKGRPYEGEQTVKLTATKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGNCFTYHVKFRGLNFPPNGPVMQKKTQGWEPHSERLFARGGMLIGNNRMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA

Excerpts

No excerpts have been added for mRtms5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change