compare

Comparison List

mRtms5

similar: Rtms5

mRtms5 is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Montipora efflorescens 25.0 kDa -

FPbase ID: FD244

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 633 54,100 0.005 0.27      

Photostability

No photostability measurements available ... add one!

mRtms5 Sequence

mRtms5 was derived from Rtms5 with the following mutations: V40A/S121R/F158R

MSVIATQMTYKVYMSGTVNGHYFEVEGDGKGRPYEGEQTAKLTVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGNCFTYHVKFRGLNFPPNGPVMQKKTQGWEPHSERLFARGGMLIGNNRMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA

Excerpts

No excerpts have been added for mRtms5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change