compare

Comparison List

rsTagRFP

rsTagRFP is a photoswitchable red fluorescent protein published in 2012, derived from Entacmaea quadricolor. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.6 kDa -

FPbase ID: 3FC3D

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
OFF     15,300 0.0013 0.02      
ON 567 585 36,800 0.11 4.05 6.6    
Edit States/Attributes

Transitions

From To Switch λ
OFF ON 440
ON OFF 567
Edit state transitions

Photostability

No photostability measurements available ... add one!

rsTagRFP Sequence

BLAST

rsTagRFP was derived from TagRFP with the following mutations: S2_S2delinsVSKGE/F80W/I121L/N143A/S158G/F174L/K182N/Y194F/*230LextN
amino acid numbers relative to eqFP578. show relative to TagRFP

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKLRGVNFPSNGPVMQKKTLGWEAATEMLYPADGGLEGRGDMALKLVGGGHLICNLKTTYRSKNPAKNLKMPGVYFVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for rsTagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Structural Basis for Reversible Photoswitching of Absorbance Spectra in Red Fluorescent Protein rsTagRFP

Pletnev S, Subach Fv, Dauter Z, Wlodawer A, Verkhusha Vv

(2012). Journal of Molecular Biology, 417(3) , 144-151. doi: 10.1016/j.jmb.2012.01.044. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change