compare

Comparison List

rsEGFP2

rsEGFP2 is a photoswitchable green fluorescent protein published in 2012, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 478 503 61,300 0.3 18.39 5.8 20.0  

Transitions

From To Switch λ
Off On 408
On Off 503

Photostability

no photostability measurements available ... add one!

rsEGFP2 Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLAYGVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for rsEGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change