compare

Comparison List

rsEGFP

rsEGFP is a photoswitchable green fluorescent protein published in 2011, derived from Aequorea victoria. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: JYYJ1

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 493 510 47,000 0.36 16.92 6.5 180.0  
Off              

Transitions

From To Switch λ
Off On 405
On Off 491

Photostability

No photostability measurements available ... add one!

rsEGFP Sequence

rsEGFP was derived from mEGFP with the following mutations: Q69L/V150A/V163S/S205N
amino acid numbers relative to avGFP. show relative to mEGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNAYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQNKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: AFM74241

Excerpts

We compared the properties of rsEGFP with that of the well-known RSFP Dronpa. With the proteins embedded in a 12.5% polyacrylamide layer and using light of 491 nm and 405 nm, a complete on–off cycle took 250 ms for Dronpa and 20 ms for rsEGFP. Dronpa went through <10 cycles before its fluorescence was reduced to 50%, whereas rsEGFP went through ∼1,200 cycles under the same conditions. To compare bleaching, Dronpa and rsEGFP were kept in the on-state by continuous irradiation at 405 nm while fluorescence was generated by irradiation at 491 nm. Whereas Dronpa fluorescence was reduced to 50% within t½ ≈ 30 s, for rsEGFP we measured t½ ≈ 800 s.

Grotjohann et al. (2011)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change