compare

Comparison List

PSmOrange

PSmOrange is a photoconvertible orange fluorescent protein published in 2011, derived from Discosoma sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: AQ8G3

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Orange 548 565 113,300 0.51 57.78 6.2 96.0  
Far-red 634 662 32,700 0.28 9.16 5.6    

Transitions

From To Switch λ
Orange Far-red 480

Photostability

No photostability measurements available ... add one!

PSmOrange Sequence

PSmOrange was derived from mOrange with the following mutations: S21T/Q64L/F99Y/L124M/K162R/P186S
amino acid numbers relative to DsRed. show relative to mOrange

MVSKGEENNMAIIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPLFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNYEDGGVVTVTQDSSLQDGEFIYKVKMRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIRMRLKLKDGGHYTSEVKTTYKAKKSVQLPGAYIVGIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for PSmOrange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change