compare

Comparison List

PS-CFP2

PS-CFP2 is a photoconvertible blue fluorescent protein, derived from Aequorea coerulescens.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea coerulescens 26.7 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Cyan 400 468 43,000 0.2 8.6      
Green 490 511 47,000 0.23 10.81      

Transitions

From To Switch λ
Cyan Green 405

Photostability

no photostability measurements available ... add one!

PS-CFP2 Sequence

PS-CFP2 was derived from PS-CFP with the following mutations: S108T/M153V/T154A/W238a_N238ddel
amino acid numbers relative to aceGFP. show relative to PS-CFP

MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVATLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKTRAEVKFEGDTLVSRIELTGTDFKEDGNILGNKMEYNYNATNVYIVADKARNGIKVNFKVRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYLEFVTAAAITHGMDELYK

Excerpts

No excerpts have been added for PS-CFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Practical three color live cell imaging by widefield microscopy

    Xia J, Kim Shh, Macmillan S, Truant R

    (2006). Biological Procedures Online, 8(1) , 63-68. doi: 10.1251/bpo119. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change