compare

Comparison List

phiYFPv

phiYFPv is a basic (constitutively fluorescent) yellow fluorescent protein published in 2013, derived from Phialidium sp. SL-2003.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Phialidium sp. SL-2003 25.9 kDa -

FPbase ID: 85KA4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
524 537 101,305 0.59 59.77      

Photostability

No photostability measurements available ... add one!

phiYFPv Sequence

GSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYD

Excerpts

No excerpts have been added for phiYFPv
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Yellow fluorescent protein phiYFPv (Phialidium): structure and structure-based mutagenesis

Pletneva Nv, Pletnev Vz, Souslova E, Chudakov Dm, Lukyanov S, Martynov Vi, Arhipova S, Artemyev I, Wlodawer A, Dauter Z, Pletnev S

(2013). Acta Crystallographica Section D Biological Crystallography, 69(6) , 1005-1012. doi: 10.1107/s0907444913004034. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change