compare

Comparison List

PAmCherry3

PAmCherry3 is a photoactivatable red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: PL518

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 570 596 21,000 0.24 5.04 6.2 25.0  
Off     6,500          

Transitions

From To Switch λ
Off On 405

Photostability

No photostability measurements available ... add one!

PAmCherry3 Sequence

PAmCherry3 was derived from mCherry with the following mutations: M18L/A57T/K70N/L83F/M136I/E144D/S146L/I161L/Q163A/D174E/I197R
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHLEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFTWDILSPQFMYGSNAYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVIQKKTMGWDALSERMYPEDGALKGELKARLKLKDGGHYEAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for PAmCherry3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change