compare

Comparison List

ofCP

ofCP is a basic (constitutively fluorescent) fluorescent protein published in 2022, derived from Olindias formosus.
+
ofCP Spectrum Fluorescent protein ofCP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Olindias formosus 25.2 kDa -

FPbase ID: 3592A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
528   94,000 0.001 0.09      

Photostability

No photostability measurements available ... add one!

ofCP Sequence

MALFAKPMNHKTEITGEFNGKCFKVVGHGSAPGGGDFRMHAYCESGTLPVSWCVLSPSIQYGFSMFTKYPNGITNFFQEAFPEGYTLDRVMTRENGGSVVSHHSYDLGKDGIMAKVSVKGEGFDPNGPTMTKGYLKVLPFVCHLYPHGAGVRMLSSVGMVKTDGSMDIFNVDSNYQPVGSRKVSVPKFHFVQHQIILMKDKSDTRDHIVMREIAVAQDPNEAQSAFRIA
GenBank: LC663961

Excerpts

No excerpts have been added for ofCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change