compare

Comparison List

mTFP1-Y67W

mTFP1-Y67W is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Clavularia sp. 26.9 kDa -

FPbase ID: 4JYN3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
424 461 3,000 0.02 0.06      

Photostability

No photostability measurements available ... add one!

mTFP1-Y67W Sequence

mTFP1-Y67W was derived from mTFP1 with the following mutations: Y105W
amino acid numbers relative to cFP484. show relative to mTFP1

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAWGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK

Excerpts

No excerpts have been added for mTFP1-Y67W
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change