compare

Comparison List

mStrawberry

mStrawberry is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing monomer with low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574 596 90,000 0.29 26.1 4.5 50.0  

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
90.6 ± 2.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
15.0 Shaner et al. (2004)

mStrawberry Sequence

mStrawberry was derived from mOFP.T.8 with the following mutations: S62T/Q64N/K194I/D196G/Q213L
amino acid numbers relative to DsRed. show relative to mOFP.T.8

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILTPNFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVELYERAEGRHSTGGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mStrawberry
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change