compare

Comparison List

mStayGold2

a.k.a. QC2-6(PT)

mStayGold2 is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Cytaeis uchidae 26.5 kDa -

FPbase ID: 95LHQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
499 509 175,000 0.79 138.25 4.8   2.83
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mStayGold2 Sequence

BLAST

mStayGold2 was derived from QC2-6 with the following mutations: *216YextSRTKLE
amino acid numbers relative to CU17S. show relative to QC2-6

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMDVSLPNEVQHIPRDDGVECTVTLTYPLLSDESKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHLYSRTKLE
GenBank: LC756334

Excerpts

In one experiment to amplify the full length of QC2-6, we accidentally used a defective reverse primer to introduce a mutation at the termination codon. The translation readthrough led to the addition of a short C-terminal tail (PT) composed of YSRTKLE. Notably, this protein product QC2-6(PT) showed high scores in OSER (82.6%) and Fluoppi (100%) assays.

Ando et al. (2023)

All things considered, we designated QC2-6 FIQ as the most useful monomeric version and named it mStayGold. We also kept QC2-6(PT) as a reserve monomer and named it mStayGold2.

Ando et al. (2023)

Primary Reference

StayGold variants for molecular fusion and membrane-targeting applications

Ando R, Shimozono S, Ago H, Takagi M, Sugiyama M, Kurokawa H, Hirano M, Niino Y, Ueno G, Ishidate F, Fujiwara T, Okada Y, Yamamoto M, Miyawaki A

(2023). Nature Methods, , . doi: 10.1038/s41592-023-02085-6. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change