compare

Comparison List

mStable

mStable is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.1 kDa -

FPbase ID: DKZQ7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
597 633 45,000 0.17 7.65      

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1002.0   Ren et al. (2016)

mStable Sequence

mStable was derived from mKate2 with the following mutations: S143C
amino acid numbers relative to eqFP578. show relative to mKate2

MVSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKAVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEACTETLYPADGGLEGRADMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHR

Excerpts

No excerpts have been added for mStable
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cysteine Sulfoxidation Increases the Photostability of Red Fluorescent Proteins

Ren H, Yang B, Ma C, Hu Ys, Wang Pg, Wang L

(2016). ACS Chemical Biology, 11(10) , 2679-2684. doi: 10.1021/acschembio.6b00579. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change