compare

Comparison List

mScarlet3-H

a.k.a. mYongHong

mScarlet3-H is a basic (constitutively fluorescent) orange fluorescent protein published in 2024, derived from synthetic construct. It is reported to be a rapidly-maturing monomer with very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 25.9 kDa -

FPbase ID: 444PN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
551 592 102,685 0.18 18.48 3.45 36.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mScarlet3-H Sequence

BLAST

mScarlet3-H was derived from mScarlet3 with the following mutations: M164H
amino acid numbers relative to mRed7. show relative to mScarlet3

MDSTEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLRVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYWKQSFPEGFKWERVMNFEDGGAVSVAQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKHALRLKDGGRYLADFKTTYRAKKPVQMPGAFNIDRKLDITSHNEDYTVVEQYERSVARHSTGGSGGS

Excerpts

No excerpts have been added for mScarlet3-H
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

mYongHong: a structure-guided design of stable and monomeric red fluorescent protein

Fu Z, Piatkevich K, Zheng Q, Wu C, Xiong H, Chang Q, Ding J, Wang S, Zhang W, Li Y, Wu Y, Liu M, Fang G, Yang Y, Xie J, Qi D, Jiang T, Fu W, Hu F, Chen Y, Yue R, Li Y, Cui Y, Li M, Fan S, Yang Y, Xu Y, Li D, Zhang F, Zhao H

(2024). , , . doi: 10.21203/rs.3.rs-4718585/v1. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change